Burkholderia thailandensis E264: BTH_II0846 Help Entry BTH_II0846        CDS       T00311                                  Name (GenBank) BapB protein   KO K02078   acyl carrier protein Organism bte  Burkholderia thailandensis E264 Pathway bte00998   Biosynthesis of various antibiotics bte01100   Metabolic pathways bte01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bte00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BTH_II0846    00074 Mycolic acid biosynthesis     BTH_II0846   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BTH_II0846 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABC35171 UniProt:  Q2T706 LinkDB All DBs Position II:988499..988780 Genome browser AA seq 93 aa AA seqDB search MTAGPQLSDAAALAAAKTLLAGMLGVPEAHIAPQQRLLDDLAMDSLELIELAMELDERWN IRLDRTRLAEVATVADVAALLGAAARPDDSGGA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgacggccggcccgcaactaagcgacgccgccgcgctcgcggcggcgaagacgctgctg gccggcatgctcggcgtgccggaagcgcacatcgcaccgcagcagcggctgctcgatgac ctggcgatggattcgctcgagctgatcgaactcgcgatggaactcgacgagcgctggaac atccgtctcgatcgcacgcggcttgccgaagtcgcaacggtggcggatgtcgccgcgctg ctcggcgcggccgcgcgcccggacgattcgggaggcgcatga

DBGET integrated database retrieval system