Burkholderia territorii: WS51_04255 Help Entry WS51_04255        CDS       T04843                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism btei  Burkholderia territorii Pathway btei00998   Biosynthesis of various antibiotics btei01100   Metabolic pathways btei01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:btei00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WS51_04255    00074 Mycolic acid biosynthesis     WS51_04255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WS51_04255 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding CagD Raf1_N Motif Other DBs NCBI-ProteinID:  AOI62843 UniProt:  A0A106MNH0 LinkDB All DBs Position 2:942082..942330 Genome browser AA seq 82 aa AA seqDB search MTDAEILERIRAIFHENFAIEPERVTPDTHLFEELDLDSIDAVDLAIKLQEMTGKRIKPE EFKSVRTVGDVIAAVHVLLARA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt gtgaccgacgcagaaatcctggagcgcatccgcgccatctttcatgagaatttcgcgatc gagccggagcgggtgacgcccgatacgcacctgttcgaagagctcgatctggacagcatc gacgcagtcgacctggcaatcaagcttcaggaaatgacaggcaagcgcatcaagcccgaa gagttcaagtccgtgcggaccgtcggtgacgttatcgccgccgttcacgtgttgctcgcg cgcgcttga

DBGET integrated database retrieval system