Burkholderia territorii: WS51_11165 Help Entry WS51_11165        CDS       T04843                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism btei  Burkholderia territorii Brite KEGG Orthology (KO) [BR:btei00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:btei03032]     WS51_11165    03036 Chromosome and associated proteins [BR:btei03036]     WS51_11165    03400 DNA repair and recombination proteins [BR:btei03400]     WS51_11165 DNA replication proteins [BR:btei03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     WS51_11165 Chromosome and associated proteins [BR:btei03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     WS51_11165 DNA repair and recombination proteins [BR:btei03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       WS51_11165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 DUF2267 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AOI64275 UniProt:  A0A103QXX1 LinkDB All DBs Position 1:complement(91465..91743) Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccgcccaaacgggcgccagcaaggctcaa accggcgaaacgctggacacgctgctcgaagtcatcaagaaggccgtgtcgaagggtgat gcggttcagctgatcggcttcggcagcttcggttcgggcaagcgcgcagcacgtacgggc cgcaacccgaagacgggcgaaaccatcaagatcccggcagccaagacggtcaagttcacg gctggcaaggcgttcaaggacgccgtcaacaagcgttaa

DBGET integrated database retrieval system