KEGG   Bacillus tequilensis: G4P54_05945
Entry
G4P54_05945       CDS       T07089                                 
Symbol
med
Name
(GenBank) transcriptional regulator Med
  KO
K05519  transcriptional activator of comK gene
Organism
bteq  Bacillus tequilensis
Brite
KEGG Orthology (KO) [BR:bteq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bteq03000]
    G4P54_05945 (med)
Transcription factors [BR:bteq03000]
 Prokaryotic type
  Other transcription factors
   Others
    G4P54_05945 (med)
SSDB
Motif
Pfam: Bmp Peripla_BP_6 LPAM_2
Other DBs
NCBI-ProteinID: QIW79366
UniProt: A0A6H0WJ17
LinkDB
Position
1132963..1133928
AA seq 321 aa
MIKRLVMIFSVLLLLSGCGQTPFKGKVEKVGMLFPDTINDLVWGTKGYKGLLNIQSKYNV
DVYYKEGVKTDEDIINAIEDFHKRGVNLLYGHGSEYAEVFNLVSEDYPDMEFVISNAKAK
ADNVTSVHFSGEAIGFFGGMTAAHMSKTNQVGVIASFTWQPEVDGFIKGAKYENPDIEVN
TEYTDHWDDDMTAVKLYQKMKNEGADVVYPAGDGYNVPVIQQIKKDGLYAIGYVTDQSDL
GENTVLTSTVQNVDKAYEIIAEQFNKGTLEGGDHYYDLKTRVVEMGTFSPLVDKDFQQRI
AKLIKTYNKTGELPKNEYGVM
NT seq 966 nt   +upstreamnt  +downstreamnt
ttgatcaaaaggcttgtcatgatcttttctgtcctccttttattgagcggatgtggacaa
actccgtttaaaggaaaagttgagaaggtcggcatgctctttcctgatacgattaatgac
ctcgtatggggcacaaaagggtataaaggattactgaatatacaatcaaaatacaatgtg
gatgtctactataaagaaggcgttaaaacagatgaagatattataaatgcgattgaggat
tttcataagcggggcgtcaatcttctctatggccatgggagtgaatatgcagaggtgttt
aacttggtcagcgaagattatccagatatggaattcgtcatttctaatgcaaaggcgaaa
gctgataatgtgacgagtgtccatttcagcggggaagcaattggcttttttggcggaatg
acagccgcccatatgtcgaaaacgaatcaggttggcgtgattgcttcttttacatggcag
cctgaagttgacggttttatcaaaggagccaaatatgaaaatccggatatagaagtaaac
acggaatatacggatcattgggatgatgatatgacagcagtaaagctttatcaaaaaatg
aagaacgagggcgcggatgttgtttatcccgcaggagacgggtataatgttcctgttatt
cagcaaatcaaaaaagacggcctttatgccatcggctacgtcacagatcaatcggatctg
ggcgagaataccgtattaaccagcactgtgcagaatgtggacaaggcctatgaaatcatc
gctgagcaattcaacaaaggcacccttgaaggcggcgatcattactacgatctgaaaacg
agagtcgttgaaatgggaactttcagcccgcttgtcgataaagattttcagcaaagaatc
gccaagctgatcaaaacatacaacaaaacaggcgaactgccaaaaaacgagtatggagtg
atgtga

DBGET integrated database retrieval system