KEGG   Bombus terrestris (buff-tailed bumblebee): 100650054
Entry
100650054         CDS       T04364                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    100650054
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bter00199]
    100650054
Enzymes [BR:bter01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     100650054
Cytochrome P450 [BR:bter00199]
 Cytochrome P450, animal type
  CYP306 family
   100650054
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100650054
NCBI-ProteinID: XP_003400316
UniProt: A0A6P3U8T5
LinkDB
Position
LG B13:7469667..7486600
AA seq 499 aa
MNFIYAIFVLFVSVLVYVFYINRKIRRLPPGPWQLPIVGYLPWIDAKKPHETLTNLSRVY
GPICGFRMGSVYTVLLSDPQLIKQTFSKDMSTGRAPLYLTHGIMKGYGLVCAEGERWKDQ
RKFVSNCLRNFGMIKHEGPKREKMEKRISDAANECAAALKNRGANGPIDPLNTLHHCMGN
LVNSIVFGKTYKEEDEVWKWLRHLQEEGVKEIGVAGPLNFLPFLRFLPRYGRTIQSIVDG
KEKTHKVYRQILEEHRAKITQASENTDRVESFLAAFDEQMRKENGTKSEFFTEPQLYHLL
ADLFGAGTDTTLTTFRWFLLFMATHPMEQEKIQSEMDLCLKEGEQPTLDDRIAMPRLEAA
IAEVQRIRTVTPLGIPHGTSEDMQIGDYDVPRGTMIVPMQWAIHTDPAYWQDPLEFRPDR
FLSDDGSFFKPESFLPFQSGKRICVGEELAKMVLFLFAGRILRAFVISVPPDEIVDLEGD
CGITLVPKPHRLMFVPRHQ
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaacttcatttacgcgatattcgttttattcgtatccgttcttgtatacgttttctat
ataaatcgaaagatacgtcgtctaccacctggtccttggcaacttccgatcgtcggctat
cttccatggatcgatgcaaaaaaaccacacgaaactctgacgaatttatccagagtttat
ggtcctatatgtggctttcgcatgggttccgtttataccgttttattgtcggatcctcaa
ttaataaagcagaccttctcgaaggatatgtccaccggtagggcacctttgtaccttaca
cacggaattatgaaaggatatggtttagtttgcgcggagggagaacggtggaaggatcag
agaaaattcgttagcaattgcttacgaaactttgggatgataaagcacgaaggaccaaag
cgagagaaaatggagaaacgaatatccgatgcagcaaatgaatgtgcagcggcactgaaa
aatcgcggggcaaatggaccgatcgatccattaaatacgcttcatcattgtatgggtaat
cttgttaatagcatcgtatttggaaaaacctataaagaggaagacgaagtttggaaatgg
ctaagacatttgcaagaagaaggagtgaaagaaattggtgtcgctggaccgctcaacttt
ttaccttttctcagattcttaccacgatacggccgaacgatacaatcaatcgtcgatgga
aaggagaaaacgcataaagtatatcggcaaatactcgaagaacaccgtgcaaagatcacg
caagcatcagagaatacggatagagtcgagagctttttagcagcattcgacgaacaaatg
aggaaagaaaacggcacaaaatccgagtttttcacagaaccccaactgtaccatttattg
gcggatctctttggtgctggaactgatactactttgaccacctttcgttggttcctttta
ttcatggctacccatcctatggagcaggaaaagatacaatcggagatggatctatgtttg
aaggaaggggagcagccgactctagacgatagaatcgctatgcctcgtctcgaagctgct
atagccgaagtgcaaaggataaggactgttacaccactcggtattcctcatggaacatca
gaggatatgcagataggtgattacgatgtaccacgcggtaccatgatcgtgccgatgcag
tgggctattcacaccgatcctgcttactggcaagatcctctcgaatttcgacccgacaga
ttcctatccgatgatggaagtttcttcaaaccggaatcgtttctcccatttcaaagtgga
aaacgcatttgcgtcggagaggaactcgctaagatggtactatttttgttcgccgggagg
atactgcgtgcattcgttatatccgtaccaccggacgagatcgtcgatctcgaaggcgat
tgcggcattacgttagtcccgaaaccacatcgcttgatgttcgttccgcgacatcaataa

DBGET integrated database retrieval system