Burkholderia thailandensis 2003015869: DR62_1192 Help Entry DR62_1192         CDS       T03763                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism btha  Burkholderia thailandensis 2003015869 Brite KEGG Orthology (KO) [BR:btha00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:btha03032]     DR62_1192    03036 Chromosome and associated proteins [BR:btha03036]     DR62_1192    03400 DNA repair and recombination proteins [BR:btha03400]     DR62_1192 DNA replication proteins [BR:btha03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DR62_1192 Chromosome and associated proteins [BR:btha03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DR62_1192 DNA repair and recombination proteins [BR:btha03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DR62_1192 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 HU-CCDC81_euk_1 HU-CCDC81_euk_2 DUF2267 Motif Other DBs NCBI-ProteinID:  AIP63989 UniProt:  A0AAW9D5C1 LinkDB All DBs Position 1:988820..989098 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDSVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccgcccagacgggcgccagcaaggctcaa accggcgaaacgctggacacgctcctcgaagtgatcaagaaggctgtgtcgaaaggcgac tcagttcaactgatcggcttcggcagcttcggttcgggcaagcgcgcagcgcgcacgggc cgtaaccccaagacgggcgagaccatcaagatcccggcggccaagacggtcaagttcacg gctggcaaggcgttcaaggacgcagtgaacaagcgctga

DBGET integrated database retrieval system