KEGG   Burkholderia thailandensis 2003015869: DR62_1389
Entry
DR62_1389         CDS       T03763                                 
Name
(GenBank) ATP synthase
  KO
K02412  flagellum-specific ATP synthase [EC:7.4.2.8]
Organism
btha  Burkholderia thailandensis 2003015869
Pathway
btha02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:btha00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    DR62_1389
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:btha02044]
    DR62_1389
   02035 Bacterial motility proteins [BR:btha02035]
    DR62_1389
Enzymes [BR:btha01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     DR62_1389
Secretion system [BR:btha02044]
 Type III secretion system
  Flagellar export apparatus
   DR62_1389
Bacterial motility proteins [BR:btha02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    DR62_1389
SSDB
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C ABC_tran AAA_16
Other DBs
NCBI-ProteinID: AIP63057
UniProt: A0AAW9D0H9
LinkDB
Position
1:complement(1197736..1199301)
AA seq 521 aa
MVNDGGGGTFGRDDLDALERELALASHGAEHDRAAAQDGGAQHHAHPRPLATGAASARAA
LANPHLANWRTHLDGMRERNARALPLRPCGRLTRAAGLVLEAIGLRLSVGAECTIELPAG
SSLPYAQAEVVGFAGERLFLMPTTAVAGVLPGARVWPLESAPVADPLAGAKRLPVGWELL
GRVVDASGRPLDNLGPLASKVDAPLTAPSINPLDREPIHHVLDVGVRAINGLLTVGRGQR
MGLFAGSGVGKSVLLGTMARYTSAEVIVIGLIGERGREVKEFIEQILGEDGLARSVVVAA
PADVSPLLRMQGAAYATTLAEYFRDQGKHVLLLMDSLTRYAMAQREIALAIGEPPATKGY
PPSVFAKLPALVERTGNGPEGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSRSL
AEAGHYPAIDIEASISRAMTALIDDAHLERVRQFKQMLSRYQRNRDLIAVGAYAPGRDAQ
LDRAIALYPRIESFLQQGFRECAPYAPSLAALDALFESEGG
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggtgaacgacggcggcggcggcacgttcggccgcgacgacctcgatgcgctcgaacgc
gagctcgcgctcgcgtcgcacggcgccgaacacgatcgcgcggccgcgcaagacggcggc
gcgcagcatcacgcgcaccctcgcccgctcgcgacgggtgcggcgagcgcacgcgcggcg
ctcgcgaatccgcatcttgcgaactggcgcacgcatctcgacggcatgcgcgagcgcaac
gcacgcgcgctgccgctgcgcccgtgcggacgcctcactcgcgcggcaggcctcgtgctc
gaagcgatcgggctgcggctgtcggtcggcgccgagtgcacgatcgagctgcccgcgggc
agttcgctgccgtatgcgcaagccgaagtcgtcggcttcgcgggcgaacgcctcttcctg
atgccgaccaccgcggtcgcgggcgtgctgcccggcgcgcgcgtgtggccgctcgaaagc
gcgcccgtcgccgatccgctcgcgggcgcgaagcgcctgcccgtcggctgggaactgctc
gggcgcgtcgtcgacgcgtcgggccgcccgctcgacaatctcgggccgctcgcgtcgaag
gtcgacgcgccgctcaccgcgccgtcgatcaacccgctcgatcgcgagccgatccatcac
gtgctcgatgtcggcgtgcgcgcgatcaacgggctcctgaccgtcggccgcggtcagcgc
atggggctcttcgcgggctcgggcgtcggcaagtccgtgctgctcggcacgatggcgcgc
tacacgagcgccgaggtgatcgtgatcggcctgatcggcgagcgcggccgcgaagtgaag
gagttcatcgagcagatcctcggcgaggacgggctcgcgcgctcggtcgtcgtcgccgcg
cccgccgacgtgtcgccgcttctgcgcatgcagggcgccgcatacgcgacgacgctcgcc
gaatactttcgcgatcagggcaagcacgtgctgctgctgatggattcgctcacgcgctac
gcgatggcgcagcgcgagatcgcgctcgcgatcggcgagccgcccgcgacgaaaggctat
ccgccgtcggtgttcgcgaagctgcccgcgctcgtcgagcgcaccggcaacggcccggaa
ggcggcggctcgatcaccgcgttctacacggtgctcaccgaaggcgacgatcagcaggac
ccgatcgccgattccgcgcgcgcgattctcgacggccacatcgtgctgtcgcgctcgctc
gcggaggccggccactatccggccatcgacattgaagcgtcgatcagccgcgcgatgacc
gcgctgatcgacgacgcgcacctcgagcgcgtgcgccagttcaagcaaatgctgtcgcgc
taccagcgcaatcgcgatctgatcgcggtcggcgcatacgcgccggggcgcgacgcgcag
ctcgaccgcgcgatcgcgctgtatccgcgcatcgaatcgttcctgcagcagggctttcga
gaatgcgcgccgtacgcgccgagcctcgccgcgctcgatgcgctgttcgaatccgaagga
ggctga

DBGET integrated database retrieval system