Burkholderia thailandensis 2003015869: DR62_2323
Help
Entry
DR62_2323 CDS
T03763
Name
(GenBank) NADH:ubiquinone oxidoreductase subunit J
KO
K00339
NADH-quinone oxidoreductase subunit J [EC:
7.1.1.2
]
Organism
btha
Burkholderia thailandensis 2003015869
Pathway
btha00190
Oxidative phosphorylation
btha01100
Metabolic pathways
Module
btha_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
btha00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
DR62_2323
Enzymes [BR:
btha01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
DR62_2323
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Oxidored_q3
DUF1774
DUF6057
Motif
Other DBs
NCBI-ProteinID:
AIP62192
UniProt:
A0AAW9CUS2
LinkDB
All DBs
Position
1:2238596..2239252
Genome browser
AA seq
218 aa
AA seq
DB search
MDFTTVLFYIFSLLLVVSGLKVITSRNPVASALFLVLAFFNAAAIWMLLEAEFLAILLVL
VYVGAVMVLFLFVVMMLDINIDVLRRDFKRFVPMATVVGAIIVVETALILWRGYGATGSP
VRDMAAGALAGMPNTKLIGKVIYTDYIFAFEIAGLVLLVAIIAAVALTAQKGKDSKRQRV
SEQVKVRREDRVRLVKMQADKPQTEAAASDAASGSSNG
NT seq
657 nt
NT seq
+upstream
nt +downstream
nt
atggacttcacgaccgtactcttctacatcttctcgctgctcctcgtggtgtcggggctg
aaggtgatcacatcgcgcaacccggtggcgtctgcgctcttcctcgtgctcgcgttcttc
aacgcggccgcgatctggatgctgctcgaggccgagttcctcgcgatcctgctggtgctc
gtctacgtgggcgcggtgatggtgctgttcctcttcgtcgtgatgatgctcgacatcaac
atcgacgtgctgcgccgtgacttcaagcgcttcgtgccgatggcgaccgtggtgggcgcg
atcatcgtcgtcgagacggcgctgatcctctggcgcggctacggcgcgacgggctcgccc
gtgcgcgacatggccgcgggcgcgctcgccggcatgccgaacacgaaactgatcggcaag
gtgatctacaccgattacatcttcgcgttcgaaatcgcgggcctcgtgctgctcgtcgcg
atcatcgcggcggtcgcgctgaccgcgcagaagggcaaggacagcaagcgccagcgcgtg
tccgagcaggtgaaggtgcgccgcgaggatcgcgtgcgtctcgtgaagatgcaagccgac
aagccgcagacggaagccgccgcgagcgacgccgcgtcgggctcgagcaacggctaa
DBGET
integrated database retrieval system