Burkholderia thailandensis 2003015869: DR62_3382 Help Entry DR62_3382         CDS       T03763                                  Name (GenBank) H-NS histone   KO K03746   DNA-binding protein H-NS Organism btha  Burkholderia thailandensis 2003015869 Brite KEGG Orthology (KO) [BR:btha00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:btha03036]     DR62_3382    03400 DNA repair and recombination proteins [BR:btha03400]     DR62_3382 Chromosome and associated proteins [BR:btha03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DR62_3382 DNA repair and recombination proteins [BR:btha03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DR62_3382 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS HalX Motif Other DBs NCBI-ProteinID:  AIP65018 UniProt:  A0AAW9CME5 LinkDB All DBs Position 2:681134..681424 Genome browser AA seq 96 aa AA seqDB search MTTYKELKARAEALSAQAEAARQAELQAAIDEVRAKVREYGLTAYEVFGYRKKADERKRG AVRPKYRDPATGATWSGRGIEPKWIRGRNRDEFLID NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgacgacatacaaggaactgaaggcccgggccgaggcgttgagcgcgcaggccgaagcg gcgcggcaggccgaattgcaggccgcgatcgatgaggtgcgcgcgaaggtgcgcgagtat ggtctcacggcatacgaagtgttcggataccgaaagaaggcagacgagcgaaagcgcggg gcggtcaggccgaagtaccgcgatccggcgacgggcgcgacctggagcgggcgcggcatc gagccgaaatggattcgcgggcgcaaccgggacgaattcctgatcgattga

DBGET integrated database retrieval system