Burkholderia thailandensis 2003015869: DR62_3385 Help Entry DR62_3385         CDS       T03763                                  Name (GenBank) BapB protein   KO K02078   acyl carrier protein Organism btha  Burkholderia thailandensis 2003015869 Pathway btha00998   Biosynthesis of various antibiotics btha01100   Metabolic pathways btha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:btha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DR62_3385    00074 Mycolic acid biosynthesis     DR62_3385   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DR62_3385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIP66939 UniProt:  A0AAW9CME1 LinkDB All DBs Position 2:685117..685398 Genome browser AA seq 93 aa AA seqDB search MTARPQLSDAAALAAAKTLLAGMLGVPEAHIAPQQRLLDDLAMDSLELIELAMELDERWN IRLDRTRLAEVATVADVAALLGAAARPDDSGGA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgacggcccgcccgcaactgagcgacgccgccgcgctcgcggcggcgaagacgctgttg gccggcatgctcggcgtgccggaagcgcacatcgcgccgcagcagcggctgctcgatgac ctggcgatggattcgctcgagctgatcgaactcgcgatggaactcgatgagcgctggaac atccgtctcgatcgcacgcggcttgccgaagtcgcaacggtggcggatgtcgccgcgctg ctcggcgcggccgcgcgcccggacgattcgggaggcgcatga

DBGET integrated database retrieval system