Burkholderia thailandensis 2003015869: DR62_5434
Help
Entry
DR62_5434 CDS
T03763
Name
(GenBank) multidrug ABC transporter ATPase
KO
K06147
ATP-binding cassette, subfamily B, bacterial
Organism
btha
Burkholderia thailandensis 2003015869
Brite
KEGG Orthology (KO) [BR:
btha00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
btha02000
]
DR62_5434
Transporters [BR:
btha02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
DR62_5434
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_membrane
SMC_N
AAA_16
AAA_22
AAA_21
AAA_24
KAP_NTPase
ABC_ATPase
PRK
Motif
Other DBs
NCBI-ProteinID:
AIP65478
LinkDB
All DBs
Position
2:complement(271303..273303)
Genome browser
AA seq
666 aa
AA seq
DB search
MVQKTTHPGGRAFTDVLAFTFRHWRAQPVRIAGIAFFALATALGDVLTPLFAGRLVDALS
HGVAAADKAAAWSRALHAFGVLIGIGIACTLLRQAVFRNIIVLTLKMMSEIAANAFHRVQ
RFSTDWHANSFAGSTVRKITRGMWAIDLLNDTLLIALLPSVVMLTGATLLLGLHWPVMGA
VVGGGSVVFIAVTVTMSLRYVAPAARLGNLWDTRMGGALADAVSCNPVVKAFGAETREEA
RLDGVVSKWRARTRRAWRRGTLNGGVQGAMLVAMQAAILGAALWLWAHDRASLGDITFAL
TTFLVLQGYLRDIGMHIRNLQRSVNDMEELVSLERQPLGIDDKPGAKPISIARGEIRFEH
VTFGYGGAHAKPLYDDFSIRIAPGERIGLVGHSGSGKTSFIKLIQRLYDVDGGRITIDGQ
NIADVTQASLRSQIAIVQQEPLLFHRTLAENIAYARPGATRDEIERAARLASAHEFIDAL
PQGYDTLVGERGIKLSGGERQRVAIARAFLADAPVLILDEATSSLDSESEVLIQQAMERL
MVGRTTLVVAHRLSTVRALDRLIVLDKGRVIEEGSHDALIRLERGVYRRLFERQALELAK
GLIEQTGGDVADWLHDEHDEHDGRDERNARGERDNPGGHGGRRTRGAFDGSRDGGQVDDS
AVAVEK
NT seq
2001 nt
NT seq
+upstream
nt +downstream
nt
atggtccagaaaactacccatccgggtggacgcgcgtttaccgacgtgctcgcgttcacc
ttccggcactggcgcgcgcaacccgtgcgcatcgccggaatcgcctttttcgcactcgcc
accgcgctcggcgacgtgctgacgccgctcttcgcgggacgcctcgtcgacgcgctgtcg
cacggcgtggccgccgccgacaaggccgcggcgtggagccgcgcgctgcatgcgttcggc
gtgctgatcggcatcggcatcgcgtgcacgctgctgcggcaggcggtgttccgcaacatc
atcgtgctgacgctgaagatgatgagcgagatcgcggcgaacgcgttccaccgcgtgcag
cgcttttcgaccgactggcacgcgaacagcttcgccggctcgaccgtgcgcaagatcacg
cgcggcatgtgggcgatcgacctgctcaacgacacgctgctcatcgcgctgctgccgtcc
gtcgtgatgctgaccggcgcgacgctgctgctcggcctgcactggccggtgatgggcgcg
gtggtgggcggcggctcggtcgtcttcatcgcggtgacggtcacgatgtcgctgcgctac
gtcgcgcccgccgcgcggctcggcaacctgtgggacacgcgcatgggcggcgcgctcgcc
gacgcggtgagctgcaacccggtcgtcaaggcgttcggcgcggagacgcgcgaagaggcg
cggctcgacggcgtcgtgtcgaagtggcgcgcgcgcacccgccgcgcgtggcggcgcggc
acgctcaacggcggcgtgcagggcgcgatgctcgtcgcgatgcaggcggcaatcctcggc
gccgcgctgtggctgtgggcgcacgaccgcgcgagcctcggcgacatcacgttcgcgctg
acgacgttcctcgtgctgcaaggctatctgcgcgacatcgggatgcacatccgcaacctg
cagcgctccgtcaacgacatggaagaactcgtgtcgctcgagcggcagccgctcggcatc
gacgacaagccgggcgcgaagccgatctcgatcgcgcgcggcgagatccgcttcgagcac
gtgaccttcggctacggcggcgcgcacgcgaagccgctatacgacgacttctcgatccgg
atcgcgccgggcgagcgaatcgggctcgtcgggcattccggttcgggcaagacctcgttc
atcaagctgatccagcggctgtacgacgtcgacggcggacgcatcacgatcgacgggcag
aacatcgcggacgtcacgcaggcgtcgctgcgcagccagatcgcgatcgtccagcaggag
ccgctgctgttccaccgcacgctcgccgagaacatcgcgtacgcgcggcccggcgcgacg
cgcgacgagatcgagcgcgccgcgcggctcgcgagcgcgcacgagttcatcgacgcgctg
ccgcagggctacgatacactcgtcggcgagcgcgggatcaagctgtcgggcggcgagcgg
cagcgcgtcgcgatcgcgcgcgcgttcctcgccgacgcgccggtgctgatcctcgacgaa
gcgacgtcgagcctcgacagcgaaagcgaagtgctgatccagcaggcgatggagcggctg
atggtggggcgcacgacgctcgtcgtcgcgcaccggttgtcgacggtgcgcgcgctcgac
cggctgatcgttctcgacaaggggcgcgtgatcgaggaaggcagccacgacgcgctgatc
cggctcgaacgcggcgtctaccggcgactgttcgagcggcaggcgctcgagctcgcgaag
gggctgatcgagcagacgggcggcgacgtcgccgactggctgcacgatgagcacgatgag
cacgacggacgcgacgagcgcaacgcgcgcggcgaacgcgacaatcccggcgggcacggc
gggcgacgcacgcgcggcgcgttcgacgggagccgcgacggcgggcaggtcgacgattcg
gcggtggcggtcgagaagtag
DBGET
integrated database retrieval system