Burkholderia thailandensis E254: BTN_2414 Help Entry BTN_2414          CDS       T03380                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bthe  Burkholderia thailandensis E254 Brite KEGG Orthology (KO) [BR:bthe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bthe03036]     BTN_2414    03400 DNA repair and recombination proteins [BR:bthe03400]     BTN_2414 Chromosome and associated proteins [BR:bthe03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTN_2414 DNA repair and recombination proteins [BR:bthe03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTN_2414 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AIT22061 LinkDB All DBs Position 1:complement(2666280..2666561) Genome browser AA seq 93 aa AA seqDB search METYLDLLAEREALMIKLDAARTQARSAALSEVKRIVEEFELTTQEVFGRAGVLRRRGKL KPKYRDPKTGATWNGRGRPPSWIAGKDRAAFVA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaaacttacctcgaccttctggcggaacgagaagccctgatgatcaagctggatgct gcgcgcacgcaggcgcgcagtgccgcgctatccgaagtgaaacgaatcgtcgaggaattc gaactcacgacgcaggaagtgttcggtcgcgcgggcgtgttgcgtcgtcgcggcaagctc aagccgaagtaccgcgatccgaagaccggtgcgacatggaacggccgcggccgcccgcct tcgtggatcgccggaaaggatcgcgccgcgttcgtcgcctga

DBGET integrated database retrieval system