Burkholderia thailandensis E254: BTN_881 Help Entry BTN_881           CDS       T03380                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bthe  Burkholderia thailandensis E254 Brite KEGG Orthology (KO) [BR:bthe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bthe03036]     BTN_881    03400 DNA repair and recombination proteins [BR:bthe03400]     BTN_881 Chromosome and associated proteins [BR:bthe03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTN_881 DNA repair and recombination proteins [BR:bthe03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTN_881 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS ROS_MUCR Rootletin Motif Other DBs NCBI-ProteinID:  AIT20330 LinkDB All DBs Position 1:complement(948044..948340) Genome browser AA seq 98 aa AA seqDB search MSQYAKIKAQIVELQAQAEEVRRQEIAAVVAELQGKIAEYGLTAQDLGFAERARRGRPPK KGPLPPKYRDPKSGSTWSGRGKPPQWIVGKNRDRFLIG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctcaatacgcgaaaatcaaggcgcagatcgtcgagcttcaggcccaggccgaagag gtgcgtcgtcaggagatcgcggccgtggtcgccgaactgcaaggcaagatcgccgagtac gggctcacggcgcaagacctgggatttgccgagcgcgcgcggcgtggccgtccgccgaag aaggggccgctgcccccgaagtaccgcgatccgaaatccggcagtacgtggagcggccgc gggaaaccgccgcaatggatcgtcggcaaaaaccgcgatcgctttttgatcggctga

DBGET integrated database retrieval system