KEGG   Burkholderia thailandensis 2002721643: BG87_3157
Entry
BG87_3157         CDS       T03882                                 
Symbol
adk
Name
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl00230  Purine metabolism
bthl00730  Thiamine metabolism
bthl01100  Metabolic pathways
bthl01110  Biosynthesis of secondary metabolites
bthl01232  Nucleotide metabolism
bthl01240  Biosynthesis of cofactors
Module
bthl_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BG87_3157 (adk)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BG87_3157 (adk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bthl04147]
    BG87_3157 (adk)
Enzymes [BR:bthl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     BG87_3157 (adk)
Exosome [BR:bthl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BG87_3157 (adk)
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid Hydin_ADK AAA_18 AAA_28
Other DBs
NCBI-ProteinID: AJX99564
LinkDB
Position
I:3575397..3576059
AA seq 220 aa
MRLILLGAPGAGKGTQANFIKEKFGIPQISTGDMLRAAVKAGTPLGVEAKAYMDEGKLVP
DSLIIGLVKERLKEADCANGYLFDGFPRTIAQADAMKEAGVAIDYVLEIDVPFSEIIERM
SGRRTHPASGRTYHVKFNPPKVEGKDDVTGEPLIQRDDDKEETVKKRLDVYEAQTKPLIT
YYGDWATRGEENGLKAPAYRKISGLGAVDEIRARVFDALK
NT seq 663 nt   +upstreamnt  +downstreamnt
atgcgtttgatcctgttgggcgcgcccggcgcgggaaagggcacccaggcaaacttcatc
aaggaaaagttcggcattccgcaaatctcgacgggcgacatgctgcgcgccgccgtgaag
gccggcacgccgctcggcgtcgaagcgaaggcgtacatggatgaaggcaagctcgtgccg
gattcgctgatcatcggcctcgtcaaggagcgcctgaaggaagcggactgcgcgaacggc
tacctgttcgacggcttcccgcgcacgatcgcgcaggccgacgcgatgaaggaagcgggc
gtcgcgatcgactacgtgctcgagatcgacgtgccgttctcggaaatcatcgagcggatg
agcggccgccgcacgcacccggcgtcgggacgcacgtaccacgtgaagttcaacccgccg
aaggtcgagggcaaggacgacgtgacgggcgagccgctgattcagcgcgacgacgacaag
gaagaaacggtgaagaagcgcctcgacgtgtacgaagcgcagacgaagccgctcatcacg
tattacggcgactgggcgacgcgcggcgaggagaacggcctgaaggcgcccgcgtaccgg
aagatctccggcctcggcgccgtcgacgaaatccgcgcgcgcgtgttcgacgcgctgaag
tga

DBGET integrated database retrieval system