KEGG   Burkholderia thailandensis 2002721643: BG87_5282
Entry
BG87_5282         CDS       T03882                                 
Name
(GenBank) cheB methylesterase family protein
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
bthl  Burkholderia thailandensis 2002721643
Pathway
bthl02020  Two-component system
bthl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bthl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BG87_5282
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BG87_5282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bthl02022]
    BG87_5282
   02035 Bacterial motility proteins [BR:bthl02035]
    BG87_5282
Enzymes [BR:bthl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BG87_5282
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     BG87_5282
Two-component system [BR:bthl02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   BG87_5282
Bacterial motility proteins [BR:bthl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BG87_5282
SSDB
Motif
Pfam: CheB_methylest Response_reg
Other DBs
NCBI-ProteinID: AJY01675
LinkDB
Position
II:2408915..2409964
AA seq 349 aa
MIRVLVIDDSATMRILLKKLIDKNEHMECVGVAPNPVAAQELLRETRPDVITLDIEMPKM
NGLDFLDRIMRLMPVAVIMISTLTEAGSESALRALELGAIDFIAKPKLDFAEGVQAYAEE
IYRKIETAGRAKVKKLTRDVPPVRMDAEPPAKPLLAEAGKDGRVVAVGASTGGTEAVKEL
LLSLPADCPPLLIAQHMPEPFMRSLAKRLDLLCAMRVKMAEDGETLRRGCVYIAPGHSNL
TIDATAAGYVCRIVRNAGEAQSDSSVDELFRSVAAAAGARGVGIVLTGSGSDGAAGARAM
MAAGAFNIAQDAETSVVYSMPDAAIAACGINEVLPLEKIAGKLMELDGA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgattcgcgtactggtgattgacgattccgcgacgatgcggatcttgctgaagaagctc
atcgacaagaacgagcacatggagtgcgtgggcgttgcgcccaatccggtggcggcccag
gaactgctccgggaaacccggccggacgtgattacgctcgatatcgaaatgccgaaaatg
aacggcctcgatttcctcgatcgcatcatgcggctgatgccggtcgcggtgatcatgatc
tccacgctgaccgaggcgggctccgaatcggcgctgcgcgcacttgaactgggcgcgatc
gacttcatcgcgaagccgaagctcgatttcgccgaaggcgtgcaggcgtacgcggaagaa
atctatcgcaagatcgagacggccgggcgagccaaggtgaagaagttgacgcgcgacgtg
ccgcccgtgcggatggacgccgaaccgcccgccaagccgctgctcgcggaggcgggcaag
gacggccgcgtcgtggcggtgggcgcctcgacgggcggaaccgaagcggtgaaggagctg
ctgctgagtcttccggcggattgtccgccgctgctgatcgcgcagcatatgcccgagccg
ttcatgcgttcgctcgcgaagcgcctcgacctgctgtgcgcgatgcgcgtcaagatggcg
gaggacggcgagacgcttcgccgcggttgcgtctatatcgcgccggggcattcgaacctg
acgatcgacgcgacggcggccgggtatgtgtgccggatcgtccggaacgcgggcgaggcg
cagtcggactcgtccgtcgacgagctgttccggtccgtggcggccgccgccggcgcgcgc
ggcgtgggcatcgtgctgactggcagtggttcggacggcgcggccggggcgcgcgcgatg
atggcggccggcgcgttcaacatcgcgcaggatgccgaaacgagcgtggtctacagcatg
ccggacgcggcgatcgccgcttgcggcatcaacgaagtcctgccgctcgagaagatcgcc
ggcaagctcatggagctcgacggcgcatga

DBGET integrated database retrieval system