Burkholderia thailandensis 2002721643: BG87_90 Help Entry BG87_90           CDS       T03882                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bthl  Burkholderia thailandensis 2002721643 Pathway bthl00190   Oxidative phosphorylation bthl01100   Metabolic pathways bthl02020   Two-component system Module bthl_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bthl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BG87_90  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BG87_90 Enzymes [BR:bthl01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BG87_90 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AJY00455 LinkDB All DBs Position I:113049..113147 Genome browser AA seq 32 aa AA seqDB search MWYFSWVLGIGVALAFGIINAMWLEARQKRDA NT seq 99 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcagctgggttctcggcatcggcgtcgcgctcgcgttcggcatcatcaat gcgatgtggctcgaggcgcggcaaaagcgagacgcgtag

DBGET integrated database retrieval system