KEGG   Bacteroides thetaiotaomicron 7330: Btheta7330_02333
Entry
Btheta7330_02333  CDS       T04540                                 
Symbol
atpC
Name
(GenBank) ATP synthase epsilon chain
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
btho  Bacteroides thetaiotaomicron 7330
Pathway
btho00190  Oxidative phosphorylation
btho01100  Metabolic pathways
Module
btho_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:btho00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Btheta7330_02333 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:btho00194]
    Btheta7330_02333 (atpC)
Photosynthesis proteins [BR:btho00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Btheta7330_02333 (atpC)
SSDB
Motif
Pfam: ATP-synt_DE_N
Other DBs
NCBI-ProteinID: ALJ41884
UniProt: A0A0P0EUG5
LinkDB
Position
2863102..2863350
AA seq 82 aa
MMKELHLSIVSPEKSVFDGEVKIVTLPGTVGSFSILPGHAPIVSSLKAGTLGYTTMDGEE
HTLDIQGGFVEMSDGTASVCVS
NT seq 249 nt   +upstreamnt  +downstreamnt
atgatgaaagaattgcatttaagtatcgtatcgcccgaaaagagcgtattcgacggagaa
gtgaagattgtcacactgccgggaacggtaggatcgttttctatcctgccgggacacgcg
ccgatcgtctcgtcattgaaagcgggaacgttgggttataccacgatggacggcgaggag
catacattggatattcagggtggttttgttgaaatgagtgacgggacagcttcggtgtgt
gtctcgtaa

DBGET integrated database retrieval system