Bacillus thuringiensis YBT-1518: YBT1518_21100 Help Entry YBT1518_21100     CDS       T02930                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bthu  Bacillus thuringiensis YBT-1518 Pathway bthu01100   Metabolic pathways bthu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bthu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     YBT1518_21100 (acpP)    00074 Mycolic acid biosynthesis     YBT1518_21100 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     YBT1518_21100 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Guanylate_cyc Motif Other DBs NCBI-ProteinID:  AHA73348 UniProt:  A0A9W3KHS0 LinkDB All DBs Position complement(4180256..4180489) Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVEETEVVPAASFKEDLGADSLDVVELVMQLEDEFEMEISDEDA EKIATVGDAVTYIESHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttttagaacgcgtaacaaaaatcatcgttgatcgtttaggagtagaagag actgaggtagtaccagctgcaagcttcaaggaagatttaggagcagactccctagatgta gtagaacttgtaatgcaattagaagatgaattcgaaatggaaatttctgatgaagatgct gaaaagattgctactgttggcgatgctgtgacttacatagagagtcatctataa

DBGET integrated database retrieval system