Bacillus thuringiensis YBT-1518: YBT1518_34476 Help Entry YBT1518_34476     CDS       T02930                                  Name (GenBank) small DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bthu  Bacillus thuringiensis YBT-1518 Brite KEGG Orthology (KO) [BR:bthu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bthu03032]     YBT1518_34476    03036 Chromosome and associated proteins [BR:bthu03036]     YBT1518_34476    03400 DNA repair and recombination proteins [BR:bthu03400]     YBT1518_34476 DNA replication proteins [BR:bthu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     YBT1518_34476 Chromosome and associated proteins [BR:bthu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     YBT1518_34476 DNA repair and recombination proteins [BR:bthu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       YBT1518_34476 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Motif Other DBs NCBI-ProteinID:  AHA75350 UniProt:  A0A9W3PJB8 LinkDB All DBs Position pBMB0230:complement(31814..31981) Genome browser AA seq 55 aa AA seqDB search MENMYSLLGFGTFEVRERAAREGRNPHTGEALTIPAGKTPAFKAGKALKEAVNAK NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atggagaacatgtacagcttacttggcttcggtaccttcgaagtaagagaacgtgctgca cgtgaagggcgcaatccacatactggtgaggcgcttactattcctgcgggaaaaacacct gcctttaaagcaggaaaagcattaaaagaagctgtaaacgctaaataa

DBGET integrated database retrieval system