Caldibacillus thermoamylovorans: CQJ30_01105 Help Entry CQJ30_01105       CDS       T06263                                  Name (GenBank) spore gernimation protein GerQ   KO K06440   similar to spore coat protein Organism bthv  Caldibacillus thermoamylovorans Brite KEGG Orthology (KO) [BR:bthv00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     CQJ30_01105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AWI10918 UniProt:  A0A2U8E7V1 LinkDB All DBs Position 197732..197977 Genome browser AA seq 81 aa AA seqDB search MDNQKLADHESLDLHEVINFKTLCLAKSKLMQGLVFDQDLRALMQKDVEQSIEALGELQA IYQRAPFEAPVPQNRPTPIVN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggataatcaaaaattagccgatcatgaatcattggatttgcatgaagttattaatttc aaaaccctttgcttagcgaaatcaaaactaatgcaaggattggtatttgatcaagatttg agagcgttaatgcaaaaagatgttgaacaatccatcgaagcgcttggggaattacaggca atttatcaacgtgcaccttttgaagctcctgttcctcaaaaccgtccaacgccaatagtc aattga

DBGET integrated database retrieval system