Caldibacillus thermoamylovorans: CQJ30_08095 Help Entry CQJ30_08095       CDS       T06263                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bthv  Caldibacillus thermoamylovorans Pathway bthv01100   Metabolic pathways bthv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bthv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CQJ30_08095    00074 Mycolic acid biosynthesis     CQJ30_08095   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CQJ30_08095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 FERM_N Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AWI12122 UniProt:  A0A2U8EBW8 LinkDB All DBs Position 1661912..1662145 Genome browser AA seq 77 aa AA seqDB search MSNVLERVTKIIVDRLGVEESKVTPEATFKEDLGADSLDVVELVMELEDEFGLQFSDEDS EKIVTVGDAVSYIESKL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtcgaacgtactggaacgtgtaacgaaaataattgttgaccgccttggggttgaggaa tcaaaagttacacctgaagccacttttaaggaagatcttggtgcagactcccttgatgta gtcgaattagtcatggaactagaggatgaatttggtctgcaattttctgatgaagattca gaaaagattgttactgtaggagatgctgtatcttacatagaaagtaaactttaa

DBGET integrated database retrieval system