Bacillus thuringiensis YWC2-8: AQ980_02775 Help Entry AQ980_02775       CDS       T04752                                  Name (GenBank) ATP synthase F0F1 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism bthy  Bacillus thuringiensis YWC2-8 Pathway bthy00190   Oxidative phosphorylation bthy01100   Metabolic pathways Module bthy_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:bthy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AQ980_02775  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:bthy00194]     AQ980_02775 Photosynthesis proteins [BR:bthy00194]  Photosystem and electron transport system   F-type ATPase [OT]    AQ980_02775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  ALL56806 UniProt:  A0A9X6ZK49 A0A0B5W8U5 LinkDB All DBs Position 492665..492883 Genome browser AA seq 72 aa AA seqDB search MSLGVIAAAIAIGLSALGAGIGNGLIVSRTIEGVARQPELKGALQTIMFIGVALVEALPI IGVVIAFIVMNK NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagtttaggtgtaatcgcagctgcaattgcaattggtttatcagcattaggtgcaggt attggtaacggtcttatcgtatcacgtacaatcgaaggtgttgctcgtcaaccagaatta aaaggcgcacttcaaacaattatgttcatcggggttgctttagttgaggcacttccaatc atcggtgtagttattgcattcatcgtaatgaacaaataa

DBGET integrated database retrieval system