Bacillus thuringiensis YWC2-8: AQ980_08135 Help Entry AQ980_08135       CDS       T04752                                  Name (GenBank) sporulation inhibitor sda   KO K06371   developmental checkpoint coupling sporulation initiation to replication initiation Organism bthy  Bacillus thuringiensis YWC2-8 Brite KEGG Orthology (KO) [BR:bthy00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     AQ980_08135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sda Motif Other DBs NCBI-ProteinID:  ALL57805 UniProt:  A0A0B5WBA7 LinkDB All DBs Position complement(1488443..1488598) Genome browser AA seq 51 aa AA seqDB search MKTKHMEQLSTELLTESYYKAKELKLNPDFILLIKQEIIRRSLEDKLVKSS NT seq 156 nt NT seq  +upstreamnt  +downstreamnt ttgaaaacaaaacatatggaacagttatccactgagttactcactgagtcttattataaa gcaaaagaactaaaattaaatcccgacttcattttacttataaaacaagaaatcattaga cgctcattagaggacaagcttgtcaaatcatcttga

DBGET integrated database retrieval system