Bacillus thuringiensis YWC2-8: AQ980_20250 Help Entry AQ980_20250       CDS       T04752                                  Name (GenBank) acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism bthy  Bacillus thuringiensis YWC2-8 Pathway bthy00975   Biosynthesis of various siderophores bthy01100   Metabolic pathways bthy01110   Biosynthesis of secondary metabolites Module bthy_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:bthy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     AQ980_20250  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bthy01008]     AQ980_20250 Polyketide biosynthesis proteins [BR:bthy01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     AQ980_20250 SSDB OrthologParalogGFIT Motif Pfam:  CFAP70_helical Motif Other DBs NCBI-ProteinID:  ALL60071 LinkDB All DBs Position complement(3894450..3894716) Genome browser AA seq 88 aa AA seqDB search MRREALKNAVLKIMIEKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDIKLCVPE DEVDPKAFLTVGSLLDFMEELQEVNVNN NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagacgggaagcgttaaagaatgccgtgttaaaaattatgatagaaaaaatggaactg aaaaatgtaacgcatttagaagaaacgatgcgcttaaatcaagatttatatatagattcg gtaatgatgttacagcttattgtatacatagaaatggatataaagctatgcgttccagag gatgaggtagatccaaaggcatttcttactgtaggatctttgcttgattttatggaggag ttacaagaagtaaatgtgaataactaa

DBGET integrated database retrieval system