KEGG   Bacillus thuringiensis YWC2-8: AQ980_24835
Entry
AQ980_24835       CDS       T04752                                 

Definition
(GenBank) hypothetical protein
  KO
K20418  L-isoleucine 4-hydroxylase [EC:1.14.11.45]
Organism
bthy  Bacillus thuringiensis YWC2-8
Brite
KEGG Orthology (KO) [BR:bthy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AQ980_24835
Enzymes [BR:bthy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.45  L-isoleucine 4-hydroxylase
     AQ980_24835
SSDB
Motif
Pfam: 2OG-Fe_Oxy_2
Other DBs
NCBI-ProteinID: ALL60951
UniProt: A0A386ZTV2
LinkDB
Position
complement(4754645..4755382)
AA seq 245 aa
MTFVLSKMSGFSIEEKVHEFESKGFLEISNEIFLQEEENHRLLTQAQLDYYNLEDDAYGE
CRARSYSRYIKYVDSPDYILDNSNDYFQSKEYNYDDGGKVRQFNSINDSFLCNPLIQNIV
RFDTEFAFKTNIIDTSKDLIIGLHQVRYKATKERPSFSSPIWLHKDDEPVVFLHLMNLSN
TAIGGDNLIANSPREINQFISLKEPLETLVFGQKVFHAVTPLGTECSTEAFRDILLVTFS
YKETK
NT seq 738 nt   +upstreamnt  +downstreamnt
atgacgtttgttcttagtaaaatgagtggctttagcatagaagaaaaggtacatgaattt
gaatctaaaggattccttgaaatttcaaatgaaatctttttacaagaggaagagaatcat
cgtctattaacacaagcacagttagattattataatttggaagatgatgcatacggtgaa
tgtcgtgctagatcttattcaaggtatataaagtatgttgattcaccagattatatttta
gataatagtaatgattacttccaatctaaagaatataactatgacgatggcgggaaagtt
agacagttcaatagcataaatgatagctttttatgtaatcctttaattcaaaatatcgtg
cgcttcgatactgaatttgcatttaaaacaaatataatagatacaagtaaagacttaatt
ataggtttacatcaagtaagatataaagctactaaagaaagaccatcttttagttcacct
atttggttacataaagatgatgaaccagtagtgtttttacaccttatgaatttaagtaat
acagctattggtggagataatttaatagctaattctcctcgggaaattaatcagtttata
agtttgaaggagcctttagaaactttagtatttggacaaaaggtcttccatgccgtaacg
ccacttggaacagaatgtagtacggaggcttttcgtgatattttattagtaacattttct
tataaggagacaaaatga

DBGET integrated database retrieval system