KEGG   Bacillus thuringiensis HD-771: BTG_29785
Entry
BTG_29785         CDS       T02293                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00770  Pantothenate and CoA biosynthesis
bti01100  Metabolic pathways
bti01240  Biosynthesis of cofactors
Module
bti_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bti00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BTG_29785 (coaD)
Enzymes [BR:bti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     BTG_29785 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig MotA_activ
Other DBs
NCBI-ProteinID: AFQ19350
UniProt: A0A9W3P0P6
LinkDB
Position
5759291..5759782
AA seq 163 aa
MTSIAISSGSFDPITLGHLDIIKRGAKVFDEVYVVVLNNSSKKPFFSVEERLELIREATK
DIPNVKVDSHSGLLVEYAKMRNANAILRGLRAVSDFEYEMQITSMNRKLDENIETFFIMT
NNQYSFLSSSIVKEVARYGGSVVDLVPPIVERALKEKFQTPLK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgacaagtatagctatttcttcaggaagttttgatccaattacccttgggcatctggat
attattaaaaggggagcaaaagtatttgatgaggtgtacgtagtcgttttaaacaattca
tcaaaaaaaccattcttttcagttgaagagcgattagaactaattcgagaagcgacaaag
gatatcccgaatgtaaaagtagattcgcatagtgggctgttagtagagtatgcaaaaatg
cgtaatgcaaatgcaatattacgtggtttacgagcagtttctgattttgaatatgagatg
caaattacttctatgaatcgaaaattagatgaaaatattgaaacattttttattatgaca
aacaaccaatattcatttttaagctcgagtattgtgaaagaagttgcgaggtatggagga
agtgtagtagatcttgtacctcctattgtggagcgtgctttaaaagaaaagtttcaaacc
ccgttaaagtga

DBGET integrated database retrieval system