Bacillus thuringiensis HD-771: BTG_30535 Help Entry BTG_30535         CDS       T02293                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bti  Bacillus thuringiensis HD-771 Pathway bti01100   Metabolic pathways bti01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bti00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BTG_30535 (acpP)    00074 Mycolic acid biosynthesis     BTG_30535 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BTG_30535 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  AFQ19500 UniProt:  A0A9W3P0V1 LinkDB All DBs Position 5885235..5885468 Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVEETEVVPAASFKEDLGADSLDVVELVMQLEDEFEMEISDEDA EKIATVGDAVTYIESHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttttagagcgcgtaacaaaaatcatcgttgatcgtttaggagtagaagag actgaggtagtaccagctgcaagcttcaaggaagatttaggagcagactccctagatgta gtagaacttgtaatgcaattagaagatgaattcgaaatggaaatttctgatgaagatgct gaaaagattgctactgttggcgatgctgtgacttacatagagagtcatctataa

DBGET integrated database retrieval system