Burkholderia thailandensis E444: BTJ_3200 Help Entry BTJ_3200          CDS       T03112                                  Name (GenBank) chaperonin 10 Kd subunit   KO K04078   chaperonin GroES Organism btj  Burkholderia thailandensis E444 Brite KEGG Orthology (KO) [BR:btj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:btj03110]     BTJ_3200    03029 Mitochondrial biogenesis [BR:btj03029]     BTJ_3200 Chaperones and folding catalysts [BR:btj03110]  Heat shock proteins   HSP10    BTJ_3200 Mitochondrial biogenesis [BR:btj03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     BTJ_3200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 ExoX-like_C Motif Other DBs NCBI-ProteinID:  AHI80310 LinkDB All DBs Position 1:3614971..3615264 Genome browser AA seq 97 aa AA seqDB search MNLRPLHDRVIVKRLDQETKTASGIVIPDAAAEKPDQGEVLAIGPGKRDDKGAPIALDVK VGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVVNAQ NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaccttcgtccgttgcacgatcgcgtgatcgtcaagcgcctggatcaggaaaccaag actgcgtcgggcatcgtcattcccgatgcagctgcggaaaagccggatcaaggcgaagtc ctggccatcggcccgggcaagcgcgatgacaagggcgctccgatcgcactcgacgtgaag gtcggcgatcgtgttctgttcggcaagtatgctggccaaaccgtcaaggtcgacggccag gaactgctcgtaatgcgcgaagaagacatcatggccgtggtcaacgctcagtaa

DBGET integrated database retrieval system