Burkholderia thailandensis E444: BTJ_5162 Help Entry BTJ_5162          CDS       T03112                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism btj  Burkholderia thailandensis E444 Brite KEGG Orthology (KO) [BR:btj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:btj03036]     BTJ_5162    03400 DNA repair and recombination proteins [BR:btj03400]     BTJ_5162 Chromosome and associated proteins [BR:btj03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTJ_5162 DNA repair and recombination proteins [BR:btj03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTJ_5162 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS HalX Motif Other DBs NCBI-ProteinID:  AHI82556 LinkDB All DBs Position 2:2187233..2187523 Genome browser AA seq 96 aa AA seqDB search MATYKELKARAEALSAQAEAARQAELQAAIDEVRAKVREYGLTAYEVFGYRKKADERKRG AVRPKYRDPATGATWSGRGIEPKWIRGRNRDEFLIE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacatacaaggaactgaaggcccgggccgaggcgttgagcgcgcaggccgaagcg gcgcggcaggccgaattgcaggccgcgatcgatgaggtgcgcgcgaaggtgcgcgagtat ggtctcacggcatacgaagtgttcggataccgaaagaaggcagacgagcgaaagcgcggg gcggtcaggccgaagtaccgcgatccggcgacgggcgcgacctggagcgggcgcggcatc gagccgaaatggattcgcgggcgcaaccgggacgaattcctgatcgagtga

DBGET integrated database retrieval system