Burkholderia thailandensis E444: BTJ_746 Help Entry BTJ_746           CDS       T03112                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism btj  Burkholderia thailandensis E444 Pathway btj00190   Oxidative phosphorylation btj01100   Metabolic pathways btj02020   Two-component system Module btj_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:btj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BTJ_746  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BTJ_746 Enzymes [BR:btj01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BTJ_746 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB B277 Motif Other DBs NCBI-ProteinID:  AHI78100 LinkDB All DBs Position 1:complement(830592..830750) Genome browser AA seq 52 aa AA seqDB search MWYFSWILGIGVALGFGIINAMWLEANGNFPTGAADDAHDASAPATPEGRRS NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttctcatggattctcggcatcggcgtcgcactcggcttcggcatcatcaac gcgatgtggctcgaggcgaacggcaacttcccgacaggcgccgccgacgacgcgcatgac gcgagcgcgcccgccacgccggagggccgacgttcgtga

DBGET integrated database retrieval system