Bacillus thuringiensis Al Hakam: BALH_3481 Help Entry BALH_3481         CDS       T00429                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism btl  Bacillus thuringiensis Al Hakam Pathway btl00998   Biosynthesis of various antibiotics btl01100   Metabolic pathways btl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:btl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BALH_3481    00074 Mycolic acid biosynthesis     BALH_3481   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BALH_3481 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  ABK86716 LinkDB All DBs Position complement(3695466..3695708) Genome browser AA seq 80 aa AA seqDB search MNGMADVLERVTKIIVDRLGVEETEVVPAASFKEDLGADSLDVVELVMQLEDEFEMEISD EDAEKIATVGDAVTYIESHL NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgaatggaatggcagatgttttagagcgtgtaacaaaaattatcgttgatcgtttagga gtagaagaaacagaagtagtaccagctgcgagcttcaaggaagatttaggagcagactcc ctagatgtagtagaacttgtaatgcaattagaagacgaattcgaaatggaaatttctgat gaagatgctgaaaagattgctactgttggcgatgctgtgacttacatagagagtcatcta taa

DBGET integrated database retrieval system