Bacillus thuringiensis HD-789: BTF1_07295 Help Entry BTF1_07295        CDS       T02411                                  Name (GenBank) acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism btn  Bacillus thuringiensis HD-789 Pathway btn00975   Biosynthesis of various siderophores btn01100   Metabolic pathways btn01110   Biosynthesis of secondary metabolites Module btn_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:btn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     BTF1_07295  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:btn01008]     BTF1_07295 Polyketide biosynthesis proteins [BR:btn01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     BTF1_07295 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding CFAP70_helical Motif Other DBs NCBI-ProteinID:  AFQ25672 LinkDB All DBs Position 1432418..1432693 Genome browser AA seq 91 aa AA seqDB search MRREALKNAVLKIMIEKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDLKLCVPE DEVDPKAFLTVGSLLDFMEELQPLQEVNVNN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagacgggaagcgttaaagaatgccgtgttaaaaattatgatagaaaaaatggaactg aaaaatgtaacgcatttagaagaaacgatgcgcttaaatcaagatttatatatagattcg gtaatgatgttacagcttattgtatacatagaaatggatttaaagctatgcgttccagag gatgaggtagatccaaaagcatttcttactgtaggatctttgcttgattttatggaggag ttacagccgttacaggaagtaaatgtgaataactaa

DBGET integrated database retrieval system