KEGG   Burkholderia thailandensis 2002721723: BTQ_3934
Entry
BTQ_3934          CDS       T03111                                 
Name
(GenBank) ABC transporter family protein
  KO
K02052  putative spermidine/putrescine transport system ATP-binding protein
Organism
btq  Burkholderia thailandensis 2002721723
Pathway
btq02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:btq00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BTQ_3934
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btq02000]
    BTQ_3934
Transporters [BR:btq02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter
    BTQ_3934
SSDB
Motif
Pfam: ABC_tran TOBE_2 SMC_N AAA_25 nSTAND3 AAA_22 AAA_29 AAA_16 DO-GTPase2
Other DBs
NCBI-ProteinID: AHI76399
LinkDB
Position
2:783936..785048
AA seq 370 aa
MKTDDVIVSFRGVRKTYDGETLVVKSLDLDIRRGEFLTLLGPSGSGKTTCLMMLAGFEFP
TGGEIRLDGELLNNVPPHKRNIGMVFQNYALFPHLSVERNVDYPLNVRRMPAAERKERVA
AALAMVQMERFAKRYPAQLSGGQQQRIALARALVFEPKLVLMDEPLGALDKQLREHMQYE
LKALHEKLGLTFVYVTHDQGEALTMSDRVAVFDKGIVQQLDTVDRLYESPCNEFVANFIG
DSNRLRGTVASVNGQFCEFRLGDGTRLVGLNAGNAQVGASGVACIRPERMNVAPGSGLAA
NGAAGGAANALSGEARSLIYFGDHVRMRCALPGQDECFVKVPLGTGTLDAFAPGSPISLE
FQPEHLRVFA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaagaccgatgatgtgatcgtcagctttcgcggcgtgcgcaagacttacgacggcgaa
acgctcgtcgtcaaatcgctcgatctggacatccggcgcggcgaattcctgacgctgctc
gggccgtccggctcgggcaagaccacctgcctgatgatgctcgccggcttcgaattcccg
acgggcggcgagattcgcctcgacggcgagctgctgaacaacgtgccgccgcacaagcgc
aacatcggcatggtgttccagaactacgcgctctttccgcatctgagcgtcgagcggaat
gtcgactatccgctgaacgtgcgccgcatgcccgccgccgagcgcaaggagcgcgtggca
gccgcgctcgcgatggtgcagatggagcgcttcgcgaagcggtatccggcgcaactgtcg
ggcggccagcagcagcggatcgcgctcgcgcgcgcgctcgtgttcgagccgaagctcgtg
ctgatggacgagccgctcggcgcgctcgacaagcaactgcgcgaacacatgcagtacgag
ctgaaagcgctgcacgagaagctcggcctgaccttcgtctacgtgacgcacgatcagggc
gaggcgctgacgatgtccgatcgcgtcgcggtgttcgacaagggcatcgtgcagcagctc
gacaccgttgaccggctctatgaatccccatgcaacgagttcgtcgcgaacttcatcggc
gacagcaaccggctgcgcggcaccgtcgcgagcgtgaacggccagttctgcgaattccgg
ctcggcgacggcacgcgtcttgtcggcctgaacgcgggcaacgcgcaagtgggcgcgtcg
ggcgtcgcgtgcattcgtcccgagcggatgaacgtcgcgccgggcagcggcctcgcggcc
aacggcgcggcgggcggtgcggcgaatgcgctgtccggcgaggcgcgcagcctcatctac
ttcggcgatcacgtccggatgcgctgcgcgctgccggggcaggacgagtgtttcgtcaag
gtgccgctcggcaccggcacgctcgacgcattcgcccccggctcgccgatctcgctcgag
ttccagccggagcatttgcgggtcttcgcatga

DBGET integrated database retrieval system