Bartonella tribocorum CIP 105476: BT_0117 Help Entry BT_0117           CDS       T00636                                  Symbol argF_(fragment_2) Name (GenBank) Ornithine carbamoyltransferase   KO K00611   ornithine carbamoyltransferase [EC:2.1.3.3] Organism btr  Bartonella tribocorum CIP 105476 Pathway btr00220   Arginine biosynthesis btr01100   Metabolic pathways btr01110   Biosynthesis of secondary metabolites btr01230   Biosynthesis of amino acids Module btr_M00844   Arginine biosynthesis, ornithine => arginine Brite KEGG Orthology (KO) [BR:btr00001]  09100 Metabolism   09105 Amino acid metabolism    00220 Arginine biosynthesis     BT_0117 (argF_(fragment_2)) Enzymes [BR:btr01000]  2. Transferases   2.1  Transferring one-carbon groups    2.1.3  Carboxy- and carbamoyltransferases     2.1.3.3  ornithine carbamoyltransferase      BT_0117 (argF_(fragment_2)) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  OTCace Motif Other DBs NCBI-ProteinID:  CAK00607 UniProt:  A9ILV8 LinkDB All DBs Position 146107..146379 Genome browser AA seq 90 aa AA seqDB search MTDTWVSMGQEFRARSHSIFQPYQVNEAFMKLAKSDALFMHCLPAHRSEEVVDTVIDGPH SVVFDEAENRLHAQKAILSWCLQDAFFSSQ NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgactgatacatgggtttccatgggacaagaatttcgtgctcgcagtcattccattttt cagccatatcaagtcaatgaagctttcatgaaattagcaaaatctgatgctctttttatg cattgtcttccagctcatcgtagtgaagaagttgtcgatactgtgattgatggaccacat tcagtcgtgttcgatgaggctgaaaatcgtcttcatgctcaaaaagcaattctttcttgg tgtttacaagatgcatttttctcttcacaatag

DBGET integrated database retrieval system