Bartonella tribocorum CIP 105476: BT_0818 Help Entry BT_0818           CDS       T00636                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism btr  Bartonella tribocorum CIP 105476 Pathway btr01100   Metabolic pathways btr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:btr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BT_0818 (acpP)    00074 Mycolic acid biosynthesis     BT_0818 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BT_0818 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  CAK01228 UniProt:  A9IRV7 LinkDB All DBs Position 864687..864923 Genome browser AA seq 78 aa AA seqDB search MSDTVERVKKIIVEHLGVNADKVVENASFIDDLGADSLDTVELVMAFEEEFGVEIPDEAA ETIFTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagtagagcgcgttaaaaaaattattgtggaacatcttggggtgaatgct gataaagtcgtagaaaatgcgagctttatcgatgatctaggggctgatagccttgatacg gttgaacttgttatggcttttgaagaagaatttggtgtagaaatcccagatgaagctgct gaaacgattttcacagttggtgatgcagtcaagttcattgataaagcttctgcataa

DBGET integrated database retrieval system