Bartonella tribocorum CIP 105476: BT_2507 Help Entry BT_2507           CDS       T00636                                  Symbol korB Name (GenBank) trans-acting regulatory protein   KO K03746   DNA-binding protein H-NS Organism btr  Bartonella tribocorum CIP 105476 Brite KEGG Orthology (KO) [BR:btr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:btr03036]     BT_2507 (korB)    03400 DNA repair and recombination proteins [BR:btr03400]     BT_2507 (korB) Chromosome and associated proteins [BR:btr03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BT_2507 (korB) DNA repair and recombination proteins [BR:btr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BT_2507 (korB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Topoisom_I_N Motif Other DBs NCBI-ProteinID:  CAK02469 UniProt:  A9IZ20 LinkDB All DBs Position complement(2440422..2440709) Genome browser AA seq 95 aa AA seqDB search MNDLKNMNFDELQEMRIQIDMELKKRQAKEKQNARRKILEIANTHGIDIADLVSKERHYR NPNNQWELWNGRGRRPKWIKEWLENGYTLDELEVT NT seq 288 nt NT seq  +upstreamnt  +downstreamnt gtgaatgatctcaaaaatatgaattttgatgaactacaagagatgcgtatacaaatcgat atggaattgaaaaaacggcaagcaaaggaaaagcaaaatgcgcgacgaaaaattcttgag attgctaatactcatggaattgatatcgctgatcttgtgagcaaagagcgtcattatagg aatcctaataaccaatgggaattatggaatgggcgtggacgtagacctaagtggattaaa gagtggttggagaatgggtatacacttgatgaactcgaagtaacataa

DBGET integrated database retrieval system