KEGG   Bordetella trematum: SAMEA390648703310
Entry
SAMEA390648703310 CDS       T04322                                 
Name
(GenBank) cointegrate resolution protein
Organism
btrm  Bordetella trematum
SSDB
Motif
Pfam: KfrA_N TcaA_2nd
Other DBs
NCBI-ProteinID: SAI72605
UniProt: A0A157K356
LinkDB
Position
1:complement(3552249..3553328)
AA seq 359 aa
MAIQQADVWEAADAVLQAGEQPTIERVRLHLGRGSPNTVGPHLKAWFQQLGPRLIASSGV
GEAPDPVRDAAQRLWAVACEAAQAEAAAAAAQAQRALQAEAEALVGERAALAQAQVRLAQ
RETDLESALTQAQGQAAAAESRCEALIEQLSERERALEALRLTLEQERQQAQQAREAAQA
ERQQGQQALAQAIQTHQRASAELEQAHREAMSQAEARHASHERRWLLDLDAQRQALRRTQ
EELEELRRSASARDAAREEALQAALQAARELERELAQLRATSAGELAVAEAQAQAQRQAF
AQQQTAQAERQADLQLRLQELQAQLQIKDGQIAALVQARALATPSSMPAPVPDTPDQTA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcgattcaacaagcggatgtctgggaagccgccgatgcggtgctgcaagccggcgag
caacccaccatcgagcgggtgcggctgcatctggggcgcggttcaccgaataccgtgggc
ccacacctgaaggcctggttccagcaactgggccctcgtctgatcgccagttcgggcgtg
ggcgaggcccccgatccggtacgcgatgcggcccagcgtctgtgggcggtggcttgcgag
gcggcgcaggccgaggccgcagcggccgccgctcaggctcagcgggcgctgcaggcagag
gccgaggcgctggtgggcgaacgcgccgcgctggctcaggcccaagtgcggctggcccag
cgcgaaaccgatctggagtctgcgctgacgcaggcccaggggcaggctgcggccgccgaa
agccgttgcgaggcgctcatcgaacagttgagcgagcgcgagcgcgcgctggaggcgttg
cgactgacgctggagcaggagcgccagcaggcgcagcaggcccgcgaagcggcgcaggcc
gaacgccagcaaggccaacaggcattggcccaggccattcagacgcaccagcgggccagc
gccgagctggagcaggcgcaccgcgaggccatgtcgcaggccgaagcgcgtcatgccagc
cacgagcggcgctggttgctggacctggacgcgcagcggcaagccctgcgccgcacccag
gaagagctggaagaactgcggcgcagcgccagcgcgcgcgatgccgctcgcgaggaggct
ttgcaggcggcgctgcaggctgcgcgcgaactggaacgcgagctggcgcaactgcgcgcg
acgtccgcaggcgagctggctgtggccgaggcccaggcccaggcgcaacgccaggccttc
gcgcagcagcagaccgcccaggcagaaaggcaggctgatctgcaactgcgtctgcaggag
ctgcaggcccagctgcagatcaaggatgggcagatcgccgccctggtgcaggcgcgcgcg
ttggcgactccctcgtcgatgcccgcgccggtgcctgacacgccggatcaaaccgcatag

DBGET integrated database retrieval system