KEGG   Bacillus tropicus: FJR70_00865
Entry
FJR70_00865       CDS       T06661                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
btro  Bacillus tropicus
Pathway
btro02020  Two-component system
btro02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:btro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FJR70_00865
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    FJR70_00865
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:btro02022]
    FJR70_00865
   02035 Bacterial motility proteins [BR:btro02035]
    FJR70_00865
Two-component system [BR:btro02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   FJR70_00865
Bacterial motility proteins [BR:btro02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    FJR70_00865
SSDB
Motif
Pfam: Response_reg DUF3798 CoA_binding_2
Other DBs
NCBI-ProteinID: QDF21674
LinkDB
Position
160540..160908
AA seq 122 aa
MAHKILVVDDAMFMRTMIKNLLKSNSEFEVIGEAENGVEAIQKYKELQPDIVTLDITMPE
MDGLEALKEIMKIDSSAKVVICSAMGQQGMVLDAIKGGAKDFIVKPFQADRVIEALTKVA
NS
NT seq 369 nt   +upstreamnt  +downstreamnt
atggcacataaaattttagttgtagacgatgcaatgtttatgcgaacgatgattaaaaac
ttattaaaaagtaattctgaatttgaggttatcggagaagcagagaatggggtagaagcg
attcaaaaatataaagaacttcaacctgatattgtaacattagatattactatgccagaa
atggacggacttgaagcattaaaagaaattatgaaaattgattcaagtgcaaaggttgtt
atttgttcagcaatgggacaacaaggtatggtattagatgcaattaagggcggagcaaag
gactttattgtaaagccattccaagcagatcgtgtaatcgaagctttaacaaaagtagca
aatagctaa

DBGET integrated database retrieval system