Bacillus tropicus: FJR70_01700 Help Entry FJR70_01700       CDS       T06661                                  Name (GenBank) ACT domain-containing protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism btro  Bacillus tropicus Pathway btro00290   Valine, leucine and isoleucine biosynthesis btro00650   Butanoate metabolism btro00660   C5-Branched dibasic acid metabolism btro00770   Pantothenate and CoA biosynthesis btro01100   Metabolic pathways btro01110   Biosynthesis of secondary metabolites btro01210   2-Oxocarboxylic acid metabolism btro01230   Biosynthesis of amino acids Module btro_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine btro_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:btro00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     FJR70_01700    00660 C5-Branched dibasic acid metabolism     FJR70_01700   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     FJR70_01700   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     FJR70_01700 Enzymes [BR:btro01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      FJR70_01700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss ACT ACT_4 Motif Other DBs NCBI-ProteinID:  QDF21830 LinkDB All DBs Position 319696..319926 Genome browser AA seq 76 aa AA seqDB search MSHTFSLVIHNEPSVLLRISGIFARRGYYISSLHLNERNTSGVSEMKLTAVCTENEATLL VSQLKKLIDVLQVNTL NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtcatactttttcactcgttattcataacgagccaagtgtcttattacgtataagt gggatttttgctcggcgtggttattatatttcttctttacatttaaacgaaagaaatact agtggtgtttctgaaatgaaactcacagcagtttgtactgaaaatgaagcgacattactt gttagtcagttaaaaaaattaattgatgtactgcaagtaaatacattataa

DBGET integrated database retrieval system