Bacillus tropicus: FJR70_12645 Help Entry FJR70_12645       CDS       T06661                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism btro  Bacillus tropicus Pathway btro01100   Metabolic pathways btro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:btro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FJR70_12645 (acpP)    00074 Mycolic acid biosynthesis     FJR70_12645 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FJR70_12645 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  QDF23822 LinkDB All DBs Position complement(2425346..2425579) Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVEETEVVPAASFKEDLGADSLDVVELVMQLEDEFEMEISDEDA EKIATVGDAVTYIESHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttttagagcgtgtaacaaaaattatcgttgatcgtttaggagtagaagaa acagaagtagtaccagctgcaagcttcaaggaagatttaggagcagactccctagatgta gtagaacttgtaatgcaattagaagacgaattcgaaatggaaatttctgatgaagatgct gaaaagattgctactgttggcgatgctgtgacttacatagagagtcatctataa

DBGET integrated database retrieval system