Bacillus tropicus: FJR70_13170 Help Entry FJR70_13170       CDS       T06661                                  Name (GenBank) HNH endonuclease   KO K07451   5-methylcytosine-specific restriction enzyme A [EC:3.1.21.-] Organism btro  Bacillus tropicus Brite KEGG Orthology (KO) [BR:btro00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02048 Prokaryotic defense system [BR:btro02048]     FJR70_13170 Prokaryotic defense system [BR:btro02048]  Restriction and modification system (R-M system)   Type IV R-M system    FJR70_13170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HNH zf-UBP Transpos_assoc Evr1_Alr HNH_5 Col-Pyo_DNase MtrG Motif Other DBs NCBI-ProteinID:  QDF26972 LinkDB All DBs Position complement(2528697..2528891) Genome browser AA seq 64 aa AA seqDB search MCKSKGKYKAAENVHHLKEVKTHPHLAMDLDNLQCLCIRCHNEVHDRLDKVEKKVPKFVN EERW NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgtgtaagtcaaaaggtaaatacaaagctgctgagaatgtgcatcaccttaaagaagtg aagacacatccacacttggcgatggatttggataacctacaatgcttatgcattagatgt cacaacgaagtacacgatcgattagataaggtcgagaagaaggtacctaagttcgttaat gaggaacggtggtag

DBGET integrated database retrieval system