Kyrpidia tusciae: Btus_0237 Help Entry Btus_0237         CDS       T01220                                  Name (GenBank) Cobalt transport protein CbiN   KO K02009   cobalt/nickel transport protein Organism bts  Kyrpidia tusciae Pathway bts02010   ABC transporters Brite KEGG Orthology (KO) [BR:bts00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     Btus_0237  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bts02000]     Btus_0237 Transporters [BR:bts02000]  ABC transporters, prokaryotic type   Metallic cation, iron-siderophore and vitamin B12 transporters    Cobalt transporter     Btus_0237    Nickel transporter     Btus_0237 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CbiN Motif Other DBs NCBI-ProteinID:  ADG05014 UniProt:  D5WSC9 LinkDB All DBs Position 217023..217331 Genome browser AA seq 102 aa AA seqDB search MRHKNHRRWGKNAFLGLLAAALAALPLLIPRTAEFQGADDRGKEMVHQLDPNYRPWFSPL WEPPGSEIESLLFSLQAALGAGVIGYSIGYLHARRRDRHESD NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaggcataaaaatcatcggcgatgggggaaaaatgcgtttctcggtttactggcggcg gctctagcggcattgccgctgttgattcccagaacagcggagtttcaaggagcggacgat cgagggaaggagatggtgcaccaactcgatcccaactaccgtccttggttttctcccttg tgggaaccccccggcagtgagatcgagagtttgctgttttctctccaggcagccttgggc gccggggttatcggctattccatcgggtatcttcatgcccgcagaagggatcgccatgag tccgattga

DBGET integrated database retrieval system