KEGG   Kyrpidia tusciae: Btus_3107
Entry
Btus_3107         CDS       T01220                                 
Name
(GenBank) phosphonate ABC transporter, ATPase subunit
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
bts  Kyrpidia tusciae
Pathway
bts02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bts00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Btus_3107
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bts02000]
    Btus_3107
Enzymes [BR:bts01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     Btus_3107
Transporters [BR:bts02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    Btus_3107
SSDB
Motif
Pfam: ABC_tran AAA_16 AAA_21 AAA_29 SMC_N nSTAND1 AAA_22 AAA_30 Adeno_IVa2 DUF3987 AAA_23 RsgA_GTPase NB-ARC AAA_33 AAA_18 ATPase_2 NACHT AAA_27 AAA_25 AAA_19 zf_C2H2_13 T4SS-DNA_transf TK ORC-CDC6-like RNA12
Other DBs
NCBI-ProteinID: ADG07721
UniProt: D5WWF6
LinkDB
Position
complement(3170389..3171147)
AA seq 252 aa
MEPILRVEHLKKVYPDGTEALREVDFTVHPGEFVAVIGPSGSGKSTLLRCVNRLVEPTQG
AVIFKGENITRAGGRRVRRLRREIGMVFQSHNLIPRISVLQNVLHGRLGYKDSFRGALGM
FSAQEKEDALRILERMGLLEQAHKRADELSGGQQQRVGIARALAQKPILILADEPIANLD
PATSESIMDHLHTICRADGITCLINLHQVAIAKKYATRIIGIHRGTKVFDGPPSKLDDRI
IGQIYYQEKAVV
NT seq 759 nt   +upstreamnt  +downstreamnt
atggaacccatattgcgggtggagcacctgaaaaaagtgtatcccgacggcaccgaagct
ctgcgggaagtggatttcaccgtccatcccggcgagtttgtggcggtcatcggtcccagc
ggttcgggcaaaagcacgctgcttcgttgtgtgaatcgcctcgtcgaaccgacccagggc
gcggtgatcttcaaaggtgaaaacatcacccgggccggcggccgccgggtgaggcgtctc
cggcgagaaatcgggatggttttccaaagccacaatttgattccccggatcagcgtcctt
caaaacgtcctgcacgggagactgggctacaaggacagcttccggggagcgctggggatg
ttcagcgcccaggaaaaggaggatgcgctgcggatcttggagcgcatgggcttattggaa
caggcgcacaaacgggcggacgaactgtccggggggcaacaacagcgggtgggcatcgcc
cgggccttggcccagaagcccatcctcatcctggccgacgagcccatcgccaacctcgat
ccggctacgtcggagagcatcatggatcatttgcacacgatctgccgggcggacggcatt
acgtgtctcatcaatttgcaccaggtggccatcgcaaaaaaatatgccacgcggatcatc
gggattcaccgaggcaccaaagtctttgacggcccgccctccaaactggacgacaggatc
atcgggcagatctattaccaggagaaagccgtggtatga

DBGET integrated database retrieval system