Bacillus thuringiensis serovar kurstaki HD73: HD73_3503
Help
Entry
HD73_3503 CDS
T02460
Name
(GenBank) hypothetical protein
KO
K06315
transcriptional regulator of the spore photoproduct lyase operon
Organism
btt
Bacillus thuringiensis serovar kurstaki HD73
Brite
KEGG Orthology (KO) [BR:
btt00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
btt03000
]
HD73_3503
Transcription factors [BR:
btt03000
]
Prokaryotic type
Other transcription factors
Others
HD73_3503
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SplA
Motif
Other DBs
NCBI-ProteinID:
AGE79081
LinkDB
All DBs
Position
complement(3368788..3369051)
Genome browser
AA seq
87 aa
AA seq
DB search
MEFSSESNTYHAGDIVYIFYRNPHTQDVANIQAAAVVNNPERPNELALFLYETYYPLTNE
MAIYATEDEANQAYTYYYGDISEGMLE
NT seq
264 nt
NT seq
+upstream
nt +downstream
nt
atggaattttcttctgaaagtaatacgtatcatgctggtgacattgtttatattttttac
cgaaatcctcatactcaagacgtagctaacatacaagctgcagcagttgtaaataatcct
gaaagacctaatgaattagcactatttctttacgaaacgtattatccactaacaaatgag
atggctatatatgctaccgaagatgaggcaaaccaagcttacacttactattatggtgat
atttcagaggggatgttagaatga
DBGET
integrated database retrieval system