Burkholderia thailandensis MSMB59: BTHA_2140 Help Entry BTHA_2140         CDS       T03416                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism btv  Burkholderia thailandensis MSMB59 Pathway btv00190   Oxidative phosphorylation btv01100   Metabolic pathways btv02020   Two-component system Module btv_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:btv00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BTHA_2140  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BTHA_2140 Enzymes [BR:btv01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BTHA_2140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB B277 Motif Other DBs NCBI-ProteinID:  AIS96374 LinkDB All DBs Position 1:complement(2333023..2333181) Genome browser AA seq 52 aa AA seqDB search MWYFSWILGIGVALGFGIINAMWLEANGNFPTGAADDAHDASAPATPEGRRS NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttctcatggattctcggcatcggcgtcgcactcggcttcggcatcatcaac gcgatgtggctcgaggcgaacggcaacttcccgacaggcgccgccgacgacgcgcatgac gcgagcgcgcccgccacgccggagggccgacgttcgtga

DBGET integrated database retrieval system