Burkholderia thailandensis MSMB59: BTHA_3638 Help Entry BTHA_3638         CDS       T03416                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism btv  Burkholderia thailandensis MSMB59 Brite KEGG Orthology (KO) [BR:btv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:btv03036]     BTHA_3638    03400 DNA repair and recombination proteins [BR:btv03400]     BTHA_3638 Chromosome and associated proteins [BR:btv03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTHA_3638 DNA repair and recombination proteins [BR:btv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTHA_3638 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AIS99158 LinkDB All DBs Position 2:98998..99258 Genome browser AA seq 86 aa AA seqDB search MDDLKQQAKTARAVELPDVIVELRKKIVEYGLTQKDLFPPRLGRPKKVDALPRPRYRDPD TGATWTGRGRAPAWIAGQDRERFLID NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttggatgatttgaagcagcaggcgaagactgcgcgcgcggtcgagttgcccgacgtgatc gtcgagctgcgcaagaagatcgtcgagtacggtctcacgcaaaaagacctgttcccgcct cgtctcggccggccgaagaaggtcgacgcgctgccgaggccgcgctatcgcgatccggac acgggggcgacatggacggggcgcggccgcgcacccgcatggatcgccgggcaggaccgc gagcggttcctgatcgattag

DBGET integrated database retrieval system