Burkholderia thailandensis MSMB59: BTHA_570 Help Entry BTHA_570          CDS       T03416                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism btv  Burkholderia thailandensis MSMB59 Brite KEGG Orthology (KO) [BR:btv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:btv03036]     BTHA_570    03400 DNA repair and recombination proteins [BR:btv03400]     BTHA_570 Chromosome and associated proteins [BR:btv03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTHA_570 DNA repair and recombination proteins [BR:btv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTHA_570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS ROS_MUCR Rootletin Motif Other DBs NCBI-ProteinID:  AIS95368 LinkDB All DBs Position 1:632854..633150 Genome browser AA seq 98 aa AA seqDB search MSQYAKIKAQIVELQAQAEEVRRQEIAAVVAELQGKIAEYGLTAQDLGFAERARRGRPPK KGPLPPKYRDPKSGSTWSGRGKPPQWIVGKNRDRFLIG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctcaatacgcgaaaatcaaggcgcagatcgtcgagcttcaggcccaggccgaagag gtgcgtcgtcaggagatcgcggccgtggtcgccgagctgcaaggcaagatcgccgagtat gggctcacggcgcaagacctgggatttgccgagcgcgcgcggcgtggccgtccgccgaag aaggggccgctgcccccgaagtaccgcgatccgaaatccggcagtacgtggagcggccgc gggaaaccgccgcaatggatcgtcggcaaaaaccgcgatcgctttttgatcggctga

DBGET integrated database retrieval system