Bacillus thuringiensis HD1011: BF38_2764
Help
Entry
BF38_2764 CDS
T03675
Name
(GenBank) aspartate aminotransferase
KO
K00812
aspartate aminotransferase [EC:
2.6.1.1
]
Organism
btw
Bacillus thuringiensis HD1011
Pathway
btw00220
Arginine biosynthesis
btw00250
Alanine, aspartate and glutamate metabolism
btw00270
Cysteine and methionine metabolism
btw00330
Arginine and proline metabolism
btw00350
Tyrosine metabolism
btw00360
Phenylalanine metabolism
btw00400
Phenylalanine, tyrosine and tryptophan biosynthesis
btw00401
Novobiocin biosynthesis
btw01100
Metabolic pathways
btw01110
Biosynthesis of secondary metabolites
btw01210
2-Oxocarboxylic acid metabolism
btw01230
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:
btw00001
]
09100 Metabolism
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
BF38_2764
00270 Cysteine and methionine metabolism
BF38_2764
00220 Arginine biosynthesis
BF38_2764
00330 Arginine and proline metabolism
BF38_2764
00350 Tyrosine metabolism
BF38_2764
00360 Phenylalanine metabolism
BF38_2764
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
BF38_2764
09110 Biosynthesis of other secondary metabolites
00401 Novobiocin biosynthesis
BF38_2764
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
btw01007
]
BF38_2764
Enzymes [BR:
btw01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.1 aspartate transaminase
BF38_2764
Amino acid related enzymes [BR:
btw01007
]
Aminotransferase (transaminase)
Class I
BF38_2764
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
DegT_DnrJ_EryC1
Aminotran_5
Beta_elim_lyase
Aminotran_3
Cys_Met_Meta_PP
OKR_DC_1
DUF3945
Motif
Other DBs
NCBI-ProteinID:
AJG77725
UniProt:
A0A0B5NMY1
LinkDB
All DBs
Position
2651461..2652648
Genome browser
AA seq
395 aa
AA seq
DB search
MKLAKRVAALTPSATLEITAKAQALKAEGHDVIGLGAGEPDFNTPEHIMDAAHKAMLEGH
TKYTPTGGLQALKQEIVKKFTRDQGIAYDPSEIIVCNGAKHALYTLFQVLLDEGDEVIIP
TPYWVSYPEQVKLAGGKPVYVEGLEGNEYKITAEQLREAITEKTKAVIINSPSNPTGMIY
SKEELQQLGEVCLEHDILIVSDEIYEKLIYGGAEYTSIAQLSNALKEQTLIINGVSKSHS
MTGWRIGYAAGNKQLIKAMTNLASHSTSNPTSIAQYGAIAAYAGSQEPVETMRQAFEERL
NIIYDKLIQIPGFTCIKPQGAFYLFPNVKEAVALSGYETVDEWAKALLEEEKVALVPGTG
FGAPNNVRLSYATSLEQVEKALERIHTFMKSKVQA
NT seq
1188 nt
NT seq
+upstream
nt +downstream
nt
atgaaattagcaaagcgagtagctgctttaacaccatctgcaactttagaaattacagca
aaggcacaagcattaaaagcagaaggtcatgatgtaattggattaggagcaggagagcct
gactttaatacgccagaacatattatggatgctgcacataaagcgatgttagaaggacat
acgaagtatacaccaacaggtggattacaagcgttaaaacaagagattgtgaagaagttt
actcgcgatcaaggaattgcgtatgatccgtccgaaattattgtatgtaacggtgcaaag
catgcattatatacattattccaggtgttacttgatgaaggagatgaagttatcatccca
acgccttactgggtaagttatcctgagcaagtaaaactcgctggaggtaagccagtttat
gtagaaggtctggaaggcaatgagtacaaaattacagcagagcagctgcgtgaggcaatt
acagagaaaacgaaagcagttattattaattcaccgagcaatccaacaggaatgatttac
agcaaagaagaattacaacagcttggagaagtatgtttagaacatgatatcttaatcgtt
tcagatgaaatttatgaaaaattaatttatggtggagcagaatatacttcaattgcccag
ctttctaatgcattaaaagaacaaacacttattattaatggtgtatctaaatctcattct
atgacaggatggcgtattggatatgcagcaggaaataagcagcttattaaagcgatgacg
aacttagcgagtcatagtacgtcaaaccctacttcaatcgctcaatacggcgcaatcgcg
gcatatgcaggctcacaagaacctgttgaaacaatgcgtcaagcatttgaagaaagatta
aacattatttatgataaattaattcaaatccctggctttacttgcattaaaccacaaggt
gcattttatttattcccgaatgtaaaagaagctgtagcgttatcaggatacgaaacggtt
gatgaatgggcaaaagctttattagaagaggaaaaagtggctcttgtaccaggtacagga
tttggtgcaccaaataacgttcgtttatcatatgcgacatctcttgaacaagtagagaaa
gcattagaacgcattcatacgtttatgaaaagtaaagtgcaagcttaa
DBGET
integrated database retrieval system