Bacillus thuringiensis HD1011: BF38_3198 Help Entry BF38_3198         CDS       T03675                                  Name (GenBank) hypothetical protein   KO K24111   aryl carrier protein AsbD Organism btw  Bacillus thuringiensis HD1011 Pathway btw00975   Biosynthesis of various siderophores btw01100   Metabolic pathways btw01110   Biosynthesis of secondary metabolites Module btw_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:btw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     BF38_3198  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:btw01008]     BF38_3198 Polyketide biosynthesis proteins [BR:btw01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     BF38_3198 SSDB OrthologParalogGFIT Motif Pfam:  CFAP70_helical Motif Other DBs NCBI-ProteinID:  AJG78352 LinkDB All DBs Position 3075651..3075926 Genome browser AA seq 91 aa AA seqDB search MRREALKNAVLKIMTEKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDVKLCVPE DEVDPKAFLTVGSLLDFMEELQPLQDVNVNN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagacgggaagcgttaaagaatgctgtattaaaaattatgacagaaaaaatggaactg aaaaatgtaacgcatttagaagaaacgatgcgtttaaatcaagatttatatattgattca gtaatgatgttacaactcattgtatatatagaaatggatgtaaagctatgcgttccagag gatgaggtagacccaaaagcatttcttactgtaggatctttgcttgattttatggaggag ttgcagccgttacaggacgtaaatgtgaataactaa

DBGET integrated database retrieval system