Bacillus thuringiensis HD1011: BF38_4900 Help Entry BF38_4900         CDS       T03675                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism btw  Bacillus thuringiensis HD1011 Brite KEGG Orthology (KO) [BR:btw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:btw03032]     BF38_4900 (hup)    03036 Chromosome and associated proteins [BR:btw03036]     BF38_4900 (hup)    03400 DNA repair and recombination proteins [BR:btw03400]     BF38_4900 (hup) DNA replication proteins [BR:btw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BF38_4900 (hup) Chromosome and associated proteins [BR:btw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BF38_4900 (hup) DNA repair and recombination proteins [BR:btw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BF38_4900 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2530 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AJG77914 UniProt:  A0A9X6ZT71 LinkDB All DBs Position 4749786..4750058 Genome browser AA seq 90 aa AA seqDB search MNKTELIKNVAQNAEISQKEATVVVQTVVESITNTLAAGEKVQLIGFGTFEVRERAARTG RNPQTGEEMQIAASKVPAFKAGKELKEAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaattaattaaaaacgtagcacaaaatgctgagatttctcaaaaagaa gctactgtagttgtacaaactgtagtagaatcaatcactaacactttagctgctggtgaa aaagtacaacttatcggattcggtacattcgaagttcgcgaaagagctgctcgtacaggc cgtaacccacaaactggtgaagaaatgcaaatcgcagcttctaaagtacctgctttcaaa gctggtaaagaactaaaagaagctgtaaaataa

DBGET integrated database retrieval system